General Information

  • ID:  hor000304
  • Uniprot ID:  A0A2P8YBG2
  • Protein name:  Allatostatin-1
  • Gene name:  ALLS
  • Organism:  Blattella germanica (German cockroach) (Blatta germanica)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Blattella (genus), Blattellinae (subfamily), Ectobiidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  LYDFGL
  • Length:  6
  • Propeptide:  MLIATFFNEKPMPGPRTCYSLQAALVLSLLLKLSSSAFATTTSAGTHAVQEESSAGGGAEILPRLEELADNSELDLVKRLYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSKMYGFGLGKRAGSDGRLYSFGLGKRDYDDYYGDDDEEDHQTSADEDIEDADSVDLMDKRDRLYSFGLGKRARPYSFGLGKRAPSSAQRLYGFGLGKRALYSFGLGKRAGGRLYSFGLGKRPVNSGRQSGSRFNFGLGKRSDDFDI
  • Signal peptide:  MLIATFFNEKPMPGPRTCYSLQAALVLSLLLKLSSSAFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibited in vitro juvenile hormone production by corpora allata from virgin females of B. germanica.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A2P8YBG2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000304_AF2.pdbhor000304_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 81620 Formula: C36H50N6O10
Absent amino acids: ACEHIKMNPQRSTVW Common amino acids: L
pI: 3.75 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: 86.67 Boman Index: 490
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 130
Instability Index: 3523.33 Extinction Coefficient cystines: 1490
Absorbance 280nm: 298

Literature

  • PubMed ID:  7846299
  • Title:  Allatostatic Neuropeptides From the Cockroach Blattella Germanica (L.) (Dictyoptera, Blattellidae). Identification, Immunolocalization and Activity